PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN28284.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family WRKY
Protein Properties Length: 188aa    MW: 21031.4 Da    PI: 9.8394
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN28284.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.55.9e-33109167159
                 ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                 ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d+ vv++tYeg H+h+
  KHN28284.1 109 LDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLTKDEGVVVTTYEGVHTHP 167
                 59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.0E-3494167IPR003657WRKY domain
SuperFamilySSF1182905.75E-30101168IPR003657WRKY domain
PROSITE profilePS5081129.895104169IPR003657WRKY domain
SMARTSM007741.5E-39109168IPR003657WRKY domain
PfamPF031067.0E-27110167IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MENYSMLFSV SNSSSYPIGV GSSQIGYSGQ SSNAFLGLRP SNELASDDHE KRQGGGDGNM  60
LMSQISGGSI NVSDELGGSG NSNNNKKKGE KKVRKPRYAF QTRSQVDILD DGYRWRKYGQ  120
KAVKNNKFPR SYYRCTHQGC NVKKQVQRLT KDEGVVVTTY EGVHTHPIEK TTDNFEHILS  180
QMKIYTPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A1e-27100168876Probable WRKY transcription factor 4
1wj2_A1e-27100168876Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0986410.0BT098641.1 Soybean clone JCVI-FLGm-12D20 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001237357.11e-138WRKY53
TrEMBLA0A0B2R8351e-139A0A0B2R835_GLYSO; Putative WRKY transcription factor 75
STRINGGLYMA19G26400.11e-138(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.11e-58WRKY DNA-binding protein 75
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]